PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.118450.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 329aa    MW: 37683.2 Da    PI: 4.7115
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.118450.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.71.7e-151663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++ Ed++l+  ++ +G ++W++ ++  g+ R++k+c++rw +yl
   Cucsa.118450.1 16 RGPWSPAEDLRLITFIQTHGHDNWRALPKQAGLLRCGKSCRLRWINYL 63
                     89******************************99************97 PP

2Myb_DNA-binding53.36.5e-1769114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T++E+e +++++k +G++ W++Ia++++ gRt++++k+ w+++l
   Cucsa.118450.1  69 RGNFTEDEEETIIKLHKTWGNK-WSKIASRLP-GRTDNEIKNVWNTHL 114
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.8E-23766IPR009057Homeodomain-like
PROSITE profilePS5129413.5691163IPR017930Myb domain
SuperFamilySSF466891.12E-2814110IPR009057Homeodomain-like
SMARTSM007172.3E-121565IPR001005SANT/Myb domain
PfamPF002491.7E-141663IPR001005SANT/Myb domain
CDDcd001672.54E-81863No hitNo description
PROSITE profilePS5129425.54564118IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.9E-2667118IPR009057Homeodomain-like
SMARTSM007172.7E-1568116IPR001005SANT/Myb domain
PfamPF002491.2E-1569114IPR001005SANT/Myb domain
CDDcd001672.38E-1071114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MGKGRAPCCD KNQVKRGPWS PAEDLRLITF IQTHGHDNWR ALPKQAGLLR CGKSCRLRWI  60
NYLRPDVKRG NFTEDEEETI IKLHKTWGNK WSKIASRLPG RTDNEIKNVW NTHLKKRLSP  120
TTKVILDDFG DEPKESSSTT SSSSFSSSSS LVSSNQTQNI ETEQLNKTNS INNNNNLFCL  180
KPKATSSLST NTSNSNSSWP QNHSDFGEEV EKNKENQQLE LELESESQSN TMEIEIPLEF  240
DKDFWNMLDL DIDLFESNEV DQNYCQGSNF GAQKNQDFEN HMWFKYLENE LGLNRPPEPD  300
GRAGVDDTTT EDHRLEDDVD PCMAYFADX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C4e-25161184105C-Myb DNA-Binding Domain
1msf_C4e-25161184105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00249DAPTransfer from AT1G79180Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819210.0LN681921.1 Cucumis melo genomic scaffold, anchoredscaffold00039.
GenBankLN7132650.0LN713265.1 Cucumis melo genomic chromosome, chr_11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004140016.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLA0A0A0KD771e-107A0A0A0KD77_CUCSA; Uncharacterized protein
STRINGPOPTR_0005s09930.14e-85(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF100293042
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G16490.12e-74myb domain protein 58